PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v1853060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family LBD
Protein Properties Length: 223aa    MW: 24304.9 Da    PI: 7.3388
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v1853060.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.91.5e-42661651100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+l
  Lj5g3v1853060.1  66 PCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVSELQAQL 159
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Lj5g3v1853060.1 160 AKAQAE 165
                      **9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.99265166IPR004883Lateral organ boundaries, LOB
PfamPF031958.9E-4366163IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MAHKVNSPPI PIHVPTMFSN SPPSSSSSPP TQSPIPFPSP SQRSPSATAA AAPPPPTSPQ  60
PVVVSPCAAC KILRRRCVEK CVLAPYFPPT DPLKFTIAHR VFGASNIIKF LQELPESQRA  120
DAVSSMVYEA NARIRDPVYG CAGAICQLQK QVSELQAQLA KAQAEMVNMQ CQHANLLALI  180
CMEMTQTQSP EQQQNIIQPQ THVDMSCFLE DNNFGSAWEP LWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1474990.0BT147499.1 Lotus japonicus clone JCVI-FLLj-12B19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003536369.11e-103PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR04e-78LBD1_ARATH; LOB domain-containing protein 1
TrEMBLI3T4511e-162I3T451_LOTJA; Uncharacterized protein
STRINGGLYMA10G35760.11e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-67LOB domain-containing protein 1